Tbc druid macrospvp youtube. What role should i play on my druid to earn a spot in raids? I want to be viable. May 12, 2025 · Recommended Restoration Druid Macros Macros are simple, in-game tools which allow you to sequence spells together, create custom names and icons, cast different abilities depending on whether the target is friendly or hostile, define targeting conditions, and much, much more. The vast majority of the TBC player base (coming from private servers) has not used this macro system because it’s not originally part of the 2. Master your class in TBC with our guides providing optimal talent builds, Best in Slot (BiS) gear, stats, gems, enchants, consumables, and more. Here’s a link https://discord. You can also find links to the detailed specialization guides below. Always updated with the latest TBC Classic information. Cyclone is an iconic Druid spell and the best crowd control in the game. Fear, Poly Jul 26, 2024 · SCG-Single button macro sets for feral druid level 80, patch 11. Nov 21, 2024 · If you are interested in more in-depth Druid guides for WoW Classic, make sure to browse the Navigation Bar below, and our list of Related Guides just beneath the Table of Contents. This makes the target affected World of Warcraft Forums May 24, 2021 · Welcome to Wowhead's Balance Druid DPS TBC Addon Guide, updated for of Burning Crusade Classic. 0: 3259: June May 12, 2025 · Recommended Feral Druid Macros Macros are simple, in-game tools which allow you to sequence spells together, create custom names and icons, cast different abilities depending on whether the target is friendly or hostile, define targeting conditions, and much, much more. To tank in dungeons and raids as Druid, use the WoW SoD Druid Tank Spec. Jan 19, 2022 · For more information on other aspects of playing a feral druid, I have already published SoM guides and am working on TBC guides which will be published in due time. Dreamstate Druid – A druid healing using a mix of the restoration and balance tree (see The Talents). Energy and global cooldown The most important resource to consider for a feral DPS is energy. Jan 30, 2022 · Warrior Druid 2v2 is an extremely powerful team composition, as the Druid's Cyclone and Entangling Roots abilities can help the Warrior to stick on targets. In this guide, we will go over everything you need to know about Macros for your Restoration Druid, explain how to make your own, and cover some of the best for both hardcore and general players alike. While only tank is considered a top tier spec, Balance brings powerful buffs and debuffs to a raid, Restoration is the most mana-efficient healer and excellent in PvP and small groups, while melee DPS is the only spec in the game that can tank and DPS at maximum efficiency with the Jun 10, 2021 · Learn how to win Arenas as a Restoration Druid in Burning Crusade Classic with our TBC Classic Arena guide, detailing best 2v2 and 3v3 compositions for Restoration Druid, best tactics to help your team win a match, best Restoration Druid talent builds for Arena, and much more. The stance numbers each refer to a Form. – For a Mage, Remove Curse could be used as a party1 macro, but not so mandatory on TBC Rogue Mage combination. Jun 12, 2021 · Warrior / Druid Warrior Druid 2v2 is an extremely powerful team composition, as the Druid's Cyclone and Entangling Roots abilities can help the Warrior to stick on targets. Mar 20, 2025 · I am excited to continue furthering our understanding of Feral Druids in TBC Classic and Season of Mastery, and we already have sim tools we're working on to that end. Very popular in the Dreamgrove Discord. I understand that currently holding shift puts Jul 29, 2014 · Hello guys, I have made a few macros on my own that is working really great. Jun 12, 2021 · This guide has been written by Abide, TBC veteran for nearly a decade. 2025: Updated buff and water/food macros. Apr 21, 2025 · Choosing the right PvP and PvE talents is a prerequisite to proper performance in PvP. Glyphs are still the same, Savage Roar and Shred ofcourse (Shred glyph makes your positional none I actually ended up making all my forms macrod to only enter said form and clicking it again exits and re-enters form instantly and I use a different button for “caster” form. Dividiremos el contenido en las siguientes secciones: Descripción. It will also starsurge triple wrath ur harm target, but Season 1 is particularly hard on Restoration Druids due to the low levels of resilience or the other stats you would need to sacrifice to get it, but they hit their stride in later seasons. #showtooltip /cast !Cat Form /startattack [form:3,harm,nodead] This is a simple macro that will activate Cat May 3, 2022 · As a Resto Druid in PvP, you have two main responsibilities: healing and crowd control. Aug 2, 2021 · The Summon Voidwalker is used when playing against melee, as it can AoE Taunt with Suffering — which reduces the enemy's chance to hit by 10% in TBC Classic — and of course the Voidwalker Sacrifice shield is still as strong as ever. Your Paladin will run out of mana and then he can't run away to drink. 3 client. Here, you will learn how all you need to know to play Balance Druid proficiently. In this guide, we will go over the best Balance Druid addons, important tools to improve a players' view of the World, highlighting important Balance Druid information and displaying it clearly. Nov 22, 2020 · Focus macros are extremely important on the Burning Crusade because there is no arena123 option on the 2. This helps increase overall damage/healing and general awareness in the arena. Feral Druids are also one of the most mobile melee classes, and you should use that to your advantage by chasing down enemies trying to kite away. Jun 10, 2021 · Learn how to win Arenas as a Balance Druid in Burning Crusade Classic with our TBC Classic Arena guide, detailing best 2v2 and 3v3 compositions for Balance Druid, best tactics to help your team win a match, best Balance Druid talent builds for Arena, and much more. They are ranging from must-haves trough very useful to more of a personal type which won't be everybody's cup of tea. However, this has changed significantly. Raciales. Specifically the pvp section. Since Druids have four distinct role/spec combinations -- Balance, Feral DPS, Feral Tank, and Restoration Healer -- make sure you go to the right set of guides for your choice. Here are a few macros that all Restoration Druids can benefit from. Topic Replies Views Activity; About the Classic category. This page is part of our Restoration Druid PvP Guide. Jun 1, 2021 · Druids are one of the top PvP healers in TBC, due to their powerful crowd control abilities and instant cast healing. Mar 5, 2025 · Welcome to Skill Capped’s Guide on the Best Macros for Restoration Druids in The War Within 11. May 3, 2022 · For a Balance Druid in PvP, abilities such as Cyclone, Bash, and Entangling Roots are just as important to the PvP rotation as offensive abilities. In 3v3, Druid + Disc Priest + Hunter (or Rogue) is your best composition. However, it replaces the healer with a Resto Druid, which adds a different set of utility to the mix. All simple, Jewelcrafting gives you an opportunity to craft powerful gems you definitely will use, while Engineering gets you a lot of useful gadgets, bombs, enchants, etc. Jan 24, 2022 · Excel at PvP as a Feral Druid in Burning Crusade Classic with our detailed TBC class guide, covering Feral Druid viability in the Arena and Battleground meta, best Feral Druid builds, PvP gearing, and more. 0: 2455: June 23, 2019 TBC Basic Tanking @ lvl 70 (work in progress) feral. ItemRack TBC Classic lets you save different sets of gear; it is very useful if you have multiple specs that you frequently play. KechhaUI Druid WeakAuras: A popular package that provides important rotational abilities and cooldowns in a concise block in the center of your screen. The key difference here is that you trade a lot of beneficial tools like shields, dispels, and pain suppression for a more mobile and tankier healer. Feral druids rip and tear through their enemies with powerful bites and bleeds. You can find him in the the Icy Veins Discord. In this guide, we will go over the best Restoration Druid addons, important tools to improve a players' view of the World, highlighting important Restoration Druid information and displaying it clearly. This macro works well provided you have Track Hidden enabled, which should be always. would you mind sharing more information, such as spec, macros, stuff that isn’t immediately clear in your vid. Oct 7, 2015 · For 2v2 setups, you can either go with a healer (disc/rsham), or with a DPS (hunter/rogue). Jun 19, 2010 · My highest rating in TBC was 2378 with 91% winratio with Druid Priest Rogue and my highest rating in WotLK was 2854 with 82% winratio with DK Druid Mage (this comp was only 3 times above 2. 05 Jan. May 24, 2021 · Welcome to Wowhead's Restoration Druid Healing TBC Macro Guide, updated for of Burning Crusade Classic. May 12, 2025 · Recommended Feral Druid Macros Macros are simple, in-game tools which allow you to sequence spells together, create custom names and icons, cast different abilities depending on whether the target is friendly or hostile, define targeting conditions, and much, much more. although i played as resto during naxx, its still a new class to me since i didn’t pvp much in duels, but need to change that now for arenas. May 3, 2022 · As a Resto Druid in PvP, you have two main responsibilities: healing and crowd control. Arena macros make gameplay feel more fluid and make it easier to make quick decisions. Feb 24, 2020 · TBC Classic. DRUID #showtooltip Remove Curse /cast [target=Verh] Remove Curse Buenas, soy Tozhu y hoy venimos con una nueva apasionante guía. While only tank is considered a top tier spec, Balance brings powerful buffs and debuffs to a raid, Restoration is the most mana-efficient healer and excellent in PvP and small groups, while melee DPS is the only spec in the game that can tank and DPS at maximum efficiency with the Mar 10, 2025 · Welcome to the WoW Classic Druid macros collection! Here you will find all the important macros for your Druid in WoW Classic Anniversary, Era, Hardcore, and WoW SoD. Easily find the Addon you are looking for by Choosing a category, Searching by name or change the expansion using the drop down on the right! Some addons are linked directly to their authors Git-Hub. Apr 21, 2025 · Balance Druids are known for strong spread pressure and securing a kill with a strong burst of single-target pressure. You can probably do a bit better with a healer if you're experienced as a feral, but playing with a DPS is a bit easier. I added also some macros which are useful for all classes and roles while I'm at it. Would recommend. Power Shifting. Skill floor is high as well, making this spec not recommended for beginners and advised to be practiced outside of Arena first. May 19, 2011 · Anti-Rogue / Feral Druid Macro. 0: 3259: June Hi all, I am new to feral and looking for macros to minimize the number of keybinds I need. Rdruid 2v2/Utility Guide: https://www. Thanks in advance guys. Working on the assumption that Classic TBC will not support this option, here is a quick introduction to focus macros such as Blind, Sap, Kick, etc. May 5, 2022 · Druids are the only class in the game capable of fulling all four roles: tank, healer, ranged DPS, and melee DPS. com Sep 13, 2017 · You're better off playing a healer (restokin or full resto druid). A few double DPS comps are right up there with them but require more coordination than your average DPS + healer comp (Rogue/Mage, Feral Druid/Rogue, Feral Druid/Hunter, Elemental Shaman/Mage). Because of the natural tankiness of the Warrior with Plate gear and high Resilience, healing over time abilities from the Druid can be a major issue for some team compositions. I will say to search first using in:tbc-arena-and-pvp the your search to help filter out other sections of the discord. /cast [mod:shift] Travel Form /cast [stance:2] Bear Form /cast [stance:1] Cat Form /cast [stance:3] Bear Form /cast [stance:0] Bear Form /cast [stance:4] Bear Form Here is my druid shapeshift macro. Jul 20, 2022 · Druids have long been considered a jack of all trades, master of none. Not all of these are my original creation and credit goes to whomever first penned the words onto paper. Apr 21, 2025 · If you were looking for WotLK Classic content, please refer to our WotLK Classic Balance Druid talents. This page is part of our Balance Druid PvP Guide. Selección de Raza. Something like: /cast [harm] Moonfire; [help] Lifebloom Or you can combine what form you are in: /cast [noform, harm] Moonfire; [form:2, harm] Rake; [help] Lifebloom Behold… Note this will take the whole macro box… Fully… This will always show the correct tooltip. Throughout Classic and TBC, macros were absolutely essential to Feral DPS gameplay as they were required to efficiently use consumables in combat; consumables could… May 24, 2021 · Welcome to Wowhead's Restoration Druid Healing TBC Addon Guide, updated for of Burning Crusade Classic. For example, Barkskin can be cast while in any form, so if you want to put it on your form-specific bar you have to duplicate it across multiple bars. Last but not least, Mage, Warlock, Druid is a caster focused comp. Jan 28, 2022 · Learn how to win Arenas as a Feral Druid in Burning Crusade Classic with our TBC Classic Arena guide, detailing best 2v2 and 3v3 compositions for Feral Druid, best tactics to help your team win a match, best Feral Druid talent builds for Arena, and much more. In TBC, Druids gain 颶風術 which is an insane crowd control. We give you a stat priority to help you choose items with the right stats, followed by advice on how to choose the rest of your gear and your trinkets. 70: 28206: March 28, 2025 Holy's-Kitty-Druid. patreon. I raid with <SF>, enjoy speedrunning and competing for the #1 world record speedrun time and I am dedicated to constantly improving my own gameplay while helping others. They allow players to use abilities on enemies without having to target them. If you were looking for WotLK Classic content, please refer to our TBC Druid addons and macros. May 2, 2022 · TBC Classic Restoration Druid PvP Guide You need 3% Spell Hit to be capped in PvP, which is of importance in order to reliably land your Cyclone s and Entangling Roots . May 24, 2021 · Welcome to Wowhead's Balance Druid DPS TBC Macro Guide, updated for of Burning Crusade Classic. 1, update: 3/1/25. Nov 18, 2024 · TBC Classic. When a target is cycloned Help/harm macros are great for reducing your binds on druid. Mar 4, 2025 · Welcome to Skill Capped’s Restoration Druid PvP Guide for The War Within 11. In this guide, we will go over everything you need to know about Macros for your Balance Druid, explain how to make your own, and cover some of the best for both hardcore and general players alike. With the increase to buff cap, healers can now comfortably use all heal-over-time effects without worrying about knocking off buffs. Jun 26, 2022 · Druids are the only class in the game capable of fulling all four roles: tank, healer, ranged DPS, and melee DPS. But if you really insist, try to find a decent rogue. These are some of the strongest Druid compositions in each Arena bracket: In 2v2, Druid + Rogue, Druid + Warlock, Druid + Disc Priest, and Druid + Hunter are your best compositions. 3. PvP Viability for Balance Druid DPS in Burning Crusade Classic Balance Druid is not that common in PvP, especially in arenas. Druids have two DPS specs, balance for ranged attack, and feral for melee close attack. TBC Resto Druid PvP BiS List Aug 2, 2021 · Welcome to our PvP Druid hub for TBC Classic. The spec is optimized Jul 4, 2021 · Enjoy my first entire wpvp video of tbc~ Expect more of these until the world dies as wpvp is the only aspect of wow I truly enjoy :3Songs are listed throug Sep 10, 2021 · Rogue, Mage, Druid works in a similar way, but features a Druid healer instead. 2! In this section of the guide, we will cover every useful macro for Restoration Druids in PvP, including Arena123 macros. Most Druids in PvP content will tend towards Resto. Jan 23, 2021 · – For a Druid, Abolish Poison is mandatory but we could also mention Lifebloom. Balance druids, in their primary form as a moonkin spell caster, unleash devastating power, channelling astral energy into a relentless storm of Starsurges. The biggest difference between the two is the addition of Cyclone With this macro a Feral Druid can use the button they normally use while in Druid or Cat form to get to bear form instead to, in combat, still give bear as expected, but in non combat give travel forms: in water anywhere, give aquatic, in fly zones give flight form, and in bear form, give druid form. There's also an important macro for spammable Pounce anti rogues, Shadowmelded players or other druids, but it's kind of complicated because you actually need 3 macros, and 2 of them have to be placed on special positions on your bars, so if you want that one, you better google it. Apr 21, 2025 · Macros are crucial to be successful in PvP. 6 [] Many druid macros make use of the stance modifier to detect which form you are taking. This guide was written in 2020 and is relevant for the WoW Classic release of the game as well as private servers. Their PvE healing is also strong, and very Mana efficient. This first MACRO is a BURST/ONE HIT MACRO that is really making its work really brutally. I mained a Warlock during TBC and Wrath, and frequented the Elitist Jerks theorycrafting forums back then as a lurker. Apr 26, 2025 · An interface is extremely personal, but I highly recommend the addons below: Raid Frames addon (Grid2, Vuhdo…)- Raid frames you can configure the way you want to show anything you need (different buffs/HoTs/CDs, every debuff for each encounter, at specific spots) Apr 21, 2025 · Balance Druids are known for strong spread pressure and securing a kill with a strong burst of single-target pressure. Best Professions for Balance Druid DPS in Burning Crusade Jan 20, 2022 · Welcome to Wowhead's Balance Druid DPS Talents TBC Guide, updated for of Burning Crusade Classic! In this guide, we will cover every Balance Druid Talent in their talent tree, how useful it is in both PvE and PvP situations, as well as covering the best Balance Druid talent builds and best Balance Druid specs in both PvE and PvP environments for The Burning Crusade Classic. It targets the nearest mob, throws up a Hunter’s Mark and sends your pet on them. Here you will find overviews of all viable PvP Druid specs, learn about their strengths, weaknesses, and best consumables and professions, as well as macros and addons for Druids. tv/earpugsSpecial thanks to SoniaEdits f Resto Druid PvP Macros I'm also wondering if anyone could make a macro that casts reju on mouseover, but if i dont have any moseover it casts on me. You'll find all of the WoW Classic Druid Macros that I have found online and considered useful. Pretty much welcoming any Resto Druid advice you might have! I've gotten up to 1700(ish) in 2's running Resto Druid / Warrior. Abide is a Warrior tank and multi-class expert currently playing on Faerlina as Horde. 5a. Apr 21, 2025 · Team composition in 2v2 or 3v3 Arena is very important, because not all classes work well together. Apr 21, 2025 · Feral Druids have two roles when in an Arena match: use your strong DoT target damage to burst enemies in stuns and use your utility healing spells to help keep your teammates alive. May 12, 2025 · Recommended Guardian Druid Macros Macros are simple, in-game tools which allow you to sequence spells together, create custom names and icons, cast different abilities depending on whether the target is friendly or hostile, define targeting conditions, and much, much more. Figured I’d just combine all the ones I found Apr 26, 2025 · Find Feral Druid Macros, WeakAuras and UI suggestions for The War Within, Patch 11. Click the links below to navigate the guide or read this page for a short introduction. When a target is Apr 7, 2025 · The Druid is a true hybrid. 2! In this section of the guide, we will cover every useful macro for Balance Druids in PvP, including Arena123 macros and focus macros. When possible, Use keybinds that are available for all forms for spells available in all forms. And use keybinds on form-specific spells on your form-specific action bar. In TBC, Druids gain Cyclone which is an insane crowd control. The Druid is one of these two classes. Some are specific for my 2v2 partner so just change name and thats it. These are both healing specs and require a different playstyle & mindset though. New Talent: Circle of the Heavens – Magical damage dealt by your spells increased by 5% (25% for Restoration Druids). All sections for Restoration Druid PvP have been divided into corresponding sections for the most optimal hero talents, class talents, spec talents, race, stats, gear, enchants, gems, and macros. Here's my TBC Resto Druid Arena GuideSupport me on Patreon! https://www. e. You can also see him live on Twitch. The UI Forums and the Druid Forums on the official World of Warcraft website are also great resources, should you need additional help. 2020: Added Details TinyThreat meter, GatherMate2, DejaClassicStats, ItemRack and a ton of PvP addons. 20 Jan. Overall, however, it's a bit weaker but still strong. This is covered in detail within the Talents and Builds section. Nonetheless, Discipline Priest has a high skill cap and outstanding players may make it to the top no less than Druids. Tank Spec for Druids. I had a really nice 1 button mount/fly/travel/aquatic macro I was using but for some reason it didn’t work in Dalaran (wouldn’t identify that I couldn’t fly and give me my ground mount). If they’re not “mandatory” on TBC, they’re still very handy when it comes to performing highly competitive 3v3. However; if someone could tell me if it’s possible to have it when I’m in Travel Form if I hold shift I can go into Cat Form. While healing is certainly important as a Resto Druid, using proper crowd control at opportune times is crucial as well as dishing out some damage when going for a kill. Druid Classic. Feral Druid Tank Guide Stat Priority Talents & Builds Pre-Raid & Best In Slot (BiS) Gems, Enchants, & … From warcrafttavern. Cata Classic. They are capable healers, damage dealers for both melee and spells, and tanking. Jun 10, 2021 · Rogue / Mage / Druid Rogue / Mage / Druid is a similar comp to RMP, it focuses on a very similar core, utilizing the Rogue and Mage synergy to control and shut down opponents. Allows you to cast heals if targeting party and offensive spells if targeting enemy. Aug 2, 2021 · Feral Druids require specific compositions in order to perform, due to their multiple flaws. Apr 21, 2025 · New Talent: Circle of the Wild – Physical damage dealt by your abilities increased by 5% (25% for Restoration Druids). Balance Druid Guide Hero Talents Leveling Easy Mode Builds and Talents Rotation, Cooldowns, and Abilities Stat Priority Gems, Enchants, and Consumables Gear and Best in Slot Mythic+ Tips Liberation of Undermine Macros and Addons Spell List Feb 25, 2025 · Welcome to our Balance Druid guide for Cataclysm Classic, tailored for PvE content. DRUID #showtooltip Remove Curse /cast [target=Verh] Remove Curse Sep 30, 2019 · I’ve spent all my time levelling a druid instead of my gnome warrior, but nevermind Thunderfury, the item I wish my gnome could get and use is a Kodo mount 😆 I don’t know why this wasn’t working for me the first time, but I eventually did get the /use [name of mount] to work. Balance Druids do use DoTs, but they are now known for their strong single-target damage and can easily kill an enemy in a stun. , the best classes to pair with it). Oct 28, 2011 · Feral Druid 1 Button PvP macro Hey guys just trying to figure out why my macro doesn't work It's suppose to target the player if not dead and then cast on it all the abilities here is the macro: Code: A large collection of TBC WoW Addons (2. Outside of that, you have the base templates, just get creative - I have 90% of my abilities bound in 10 buttons on the druid, simply by having conditional macros to allow using 1 button for 2-4 actions depending on form. Apr 26, 2025 · Find Feral Druid Macros, WeakAuras and UI suggestions for The War Within, Patch 11. Hope I helpped someone. Jun 12, 2021 · 2021-06-12 Atlas Loot TBC Classic shows you all of the available loot in the game. I've tried some different things but I dont get it to work. com/earpugsI stream sometimes twitch. Come join the Druid Discord if you'd like to participate! Best Consumables for Feral Druid Tank in Season of Mastery. Mar 2, 2022 · Welcome to Wowhead's Balance Druid Arena PvP Guide, up to date for 9. I noticed at the start of the expac that I was flipping through a couple dozen forum posts, wowhead articles and old guides; sometimes dating back all the way to wrath, trying to find some very specific macros to work with all the new spell combos and button bloat the new talent tree brought; It was pretty time consuming and a little annoying. Brighter Shores 1 Druid Macro Guide 2 Hunter Macro Guide 3 Mage Macro Guide 4 Paladin Macro Guide 5 Rogue Macro Guide 6 Aug 17, 2022 · I played a Hunter Main throughout Vanilla and TBC and am excited to get back to my roots with the release of Classic TBC. 4. WoW Classic Druid Macros. Basically any idea for combining skills/trinkets, etc would be very helpful. 4 Siege of Orgrimmar for Mists of Pandaria! Druids can do just about anything and do it really well. I heard they get better in BC. If you sense a hidden enemy is stalking you, or you happen to hear the stealth sound from a nearby rogue or druid, just start spamming this macro. 1. Nov 21, 2023 · Macros PvP Dueling PvP BiS Gear Warsong Gulch Tips Alterac Valley Tips Arathi Basin Tips About the Author My name is NerdEgghead, and I am an avid Classic WoW fan and theorycrafter with roots back in retail TBC. May 3, 2022 · New to Phase 2, the lowest tier of the set—previously accessible only via PvP—can be purchased from Outland reputation vendor belonging to the five major fractions: Honor Hold or Thrallmar of Hellfire Peninsula against the Citadel, The Sha'tar of Shattrath against Tempest Keep, Cenarion Expedition of Zangarmarsh against the Coilfang, Keepers of Time of Tanaris' Cavern of Time against Nov 17, 2024 · 12 Feb. A 21point talent in the restoration that all full-time healing druids will have. Works for all Druid specs with consistent themes. A few things for druid. Here we go: 1 - Wild Growth at myself. May 6, 2022 · Druids are the only class in the game capable of fulling all four roles: tank, healer, ranged DPS, and melee DPS. Nonetheless, with Classic (and TBC Classic) such options are now There’s a lot but I would recommend going to the Druid discord. Overview Leveling (1-60) Beginners Talents & Builds BiS Gear Rotation & Abilities Stats Enchants Consumables Addons Macros PvP noduel-classic-wow]Dueling PvP BiS 2021-05-10 PvE Feral Druid Tank Talents & Builds. 2k worldwide, pretty exotic comp but STILL viable but this is a point I'll get later on). Jun 13, 2021 · All in all, these warrant Discipline Priest the A tier, somewhat below Druid. Here are a few macros that all Balance Druids can benefit from. A lo largo de la siguiente guía veremos cómo sacar el máximo rendimiento a esta clase durante el contenido de TBC. March 30, 2022 • Oxykitten. In most cases, Jewelcrafting and Engineering will be BiS choice for Druid. The addition of Tree of Life and Lifebloom bolster the iconic HoT playstyle. A Druid can. Apr 21, 2025 · This makes it so abilities that are not associated with your specialization get empowered. Restoration Druid – A druid healing using mainly the Restoration Tree, and most of the time Tree of Life (see The Talents). maining resto druid myself with similar gear. Out of the 9 playable WoW Classic classes, only two classes can take on 4 different play styles. tv/mmarkersSolo Shuffle / 3v3 Clone Heavy Build: BkGA Nov 9, 2022 · In addition to the optimisations you can make to your character and to your gameplay, having useful addons and macros can impact your performance in raids. WotLK Classic. En este caso hablaremos sobre el Druida. Jun 14, 2021 · TBC Classic Guide to Hunters' Best Macros Last updated on Jun 14, 2021 at 08:27 by Impakt 1 comment Welcome to our Macros guide for Hunter, where you will find out what the best Macros are for your Hunter in The Burning Crusade Classic. Apr 26, 2025 · An interface is extremely personal, but I highly recommend the addons below: Raid Frames addon (Grid2, Vuhdo…)- Raid frames you can configure the way you want to show anything you need (different buffs/HoTs/CDs, every debuff for each encounter, at specific spots) Get great Wow druid macros that work every time. My current talents are now 3,1,3,2,3,3 so I added Nature’s Vigil together with Incarnation, and guess what? OVERPOWERED DAMAGE. They can heal, and tank, and have a melee and ranged DPS build. While only tank is considered a top tier spec, Balance brings powerful buffs and debuffs to a raid, Restoration is the most mana-efficient healer and excellent in PvP and small groups, while melee DPS is the only spec in the game that can tank and DPS at maximum efficiency with the Nov 21, 2024 · Macros PvP noduel-classic-wow]Dueling PvP BiS Gear Warsong Gulch Tips Alterac Valley Tips Arathi Basin Tips About the Author My name is NerdEgghead, and I am an avid Classic WoW fan and theorycrafter with roots back in retail TBC. 2. – For a Warlock, its pet’s Devour Magic is a mandatory ability to have bound for fast dispels on the rogue in case of controls (eg. 4: 1604: February 24, 2025 May 16, 2018 · World Of Warcraft Arena: Macro Guide Hello, PvPers! Welcome to Bolt's PvP macro guide! The guide below will feature comprehensive coverage of all things relating to macros in World of Warcraft arena. This guide goes through the various talent choices available to you as a Balance Druid and gives you the best combinations you can take. I rerolled from resto druid but I have some amazing macros that will be very useful for some of you. Apr 21, 2025 · Choosing your gear carefully is important for your Restoration Druid in PvP. 5). For example, Restoration Druids will have enhanced Balance Druid spells, reducing the cast time of Balance spells by 30% and damage increased by 20%. Estadísticas. Stance Number Variations 4. Balance in particularly used to be considered a complete meme, having terrible mana issues, low damage, and an incredibly simple rotation in Classic. Throughout Classic and TBC, macros were absolutely essential to Feral DPS gameplay as they were required to efficiently use consumables in combat; consumables could… Feb 18, 2022 · Excel at PvP as a Warlock in Burning Crusade Classic with our detailed TBC class guide, covering Warlock viability in the Arena and Battleground meta, best Warlock builds, PvP gearing, and more. May 3, 2024 · WotLK Classic Druid Best Professions. The spec is optimized Nov 9, 2022 · In addition to the optimisations you can make to your character and to your gameplay, having useful addons and macros can impact your performance in raids. Jun 1, 2021 · TBC Classic Druid Macro Templates. 0. Brighter Shores 1 Druid Macro Guide 2 Hunter Macro Guide 3 Mage Macro Guide 4 Paladin Macro Guide 5 Rogue Macro Guide 6 dude thanks for sharing. Jul 19, 2022 · Throughout Classic and TBC, macros were absolutely essential to Feral tank gameplay as they were required to safely use consumables while tanking; consumables could… In addition to the optimisations you can make to your character and to your gameplay, having useful addons and macros can impact your performance in raids. Feb 22, 2022 · Welcome to Wowhead's Restoration Druid Arena PvP Guide, up to date for 9. Using PvP gear with Resilience is generally the way to go, but it can be useful to also use some PvE items for increased DPS, especially if you have access to strong raid gear We would like to show you a description here but the site won’t allow us. This includes mouseover macros and macros for all roles the Druid can take on in WoW Classic. Jun 7, 2021 · If you are looking for detailed information on how to master the Druid in Classic WoW, click on our Druid Class Guides below. Here, we give you the best compositions you can have for your Restoration Druid (i. If you find an Addon that has a broken download link or […] Class guides for all Druid specializations in World of Warcraft: Burning Crusade Classic: Balance Druid, Feral Druid Tank, Feral Druid DPS, Restoration Druid. You'll obviously pick up Moonkin Form and any talents that improve Starfire or Moonfire. Rogue / Warlock / Shaman Similar to the Rogue / Warlock / Druid team, this team swaps the Druid for a Shaman. 5, written by Cheesey. Every macro should work. 3). These issues were slightly improved in TBC, but the spec was ultimately slightly on… Jun 10, 2021 · The healing Druid offers the very powerful Cyclone which has both offensive and defensive uses, and a Druid is a very slippery healer that is difficult to pin down and kill since they are so mobile. Attune is a great, lightweight addon to track your own and your guild-mates attunement status to various different raids and dungeons. 5 . May 12, 2025 · Shrom's Druid Package: One of the longest running Balance Druid Weakaura packs. May 28, 2021 · Best PvE Spec for Balance Druid DPS in Burning Crusade The best PvE spec for Balance Druid DPS is filling out most of the Balance tree. Jan 7, 2021 · Was trying to get good macros for Feral druid on internet, but some are for different expansions and do not work in 3. Each macro is tested in World of Warcraft patch 5. Apr 21, 2025 · On this page, you will find a number of useful macros and addons to make your life easier when playing your Restoration Druid in World of Warcraft — The War Within (11. It works perfectly. If anyone has advice for that specific comp that would be great too. May 28, 2021 · Viability of Restoration Druid Healing in Burning Crusade PvE Content Resto Druids get some fantastic changes in TBC. NS – Nature’s Swiftness. Warrior/Paladin is not bad but just outclassed by Warrior/Druid. Saw another Druid recommend it long ago and it’s definitely been my favorite setup for pvp. maybe addon tipps. They are also excellent tanks, and can do good melee DPS with their tanking talents. Apr 7, 2025 · The Druid is a true hybrid. Estilo de Sep 30, 2019 · I’ve spent all my time levelling a druid instead of my gnome warrior, but nevermind Thunderfury, the item I wish my gnome could get and use is a Kodo mount 😆 I don’t know why this wasn’t working for me the first time, but I eventually did get the /use [name of mount] to work. com/watch?v=Hr6zdlap0yUFollow Me Twitch: https://twitch. I think I did ok for my first try. 2020: Split the page into Mage macros and Mage addons. gg/5kZN56jj. pqzmlyhcwutmjmgbmmmwrdvtqaedmyyqerhtvgqlqpswthjkjge